PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.5G247000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 299aa    MW: 31897.4 Da    PI: 8.2054
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.5G247000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.83.9e-165198148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT eEd++lv ++ ++G g+W+  ar  g++R +k+c++rw++yl
  Sevir.5G247000.1.p 51 KGPWTLEEDLILVGYISEHGEGSWDNLARAAGLNRNGKSCRLRWLNYL 98
                        79********************************************97 PP

2Myb_DNA-binding44.14.8e-14105147246
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         g+ T+ Ed  + ++++ lG++ W++I++ ++ gRt++++k++w++
  Sevir.5G247000.1.p 105 GSITPAEDAAIRELHAALGNK-WSKISKLLP-GRTDNEIKNYWRT 147
                         5679*****************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.34446102IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-1946100IPR009057Homeodomain-like
SuperFamilySSF466898.17E-3049145IPR009057Homeodomain-like
SMARTSM007177.2E-1350100IPR001005SANT/Myb domain
PfamPF002492.7E-145198IPR001005SANT/Myb domain
CDDcd001674.97E-105398No hitNo description
Gene3DG3DSA:1.10.10.602.3E-23101152IPR009057Homeodomain-like
SMARTSM007179.1E-13103151IPR001005SANT/Myb domain
PROSITE profilePS5129418.566103153IPR017930Myb domain
PfamPF002491.1E-12105147IPR001005SANT/Myb domain
CDDcd001671.65E-10108147No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MTGAERSTST LASACVSSVR YRTDPRTESK EMATRVAMAC GRAGDQPAVR KGPWTLEEDL  60
ILVGYISEHG EGSWDNLARA AGLNRNGKSC RLRWLNYLRP GVRHGSITPA EDAAIRELHA  120
ALGNKWSKIS KLLPGRTDNE IKNYWRTRIQ KKPAAAAKAP HQQPPAAVVS EGASSAAGDY  180
YWCGAKPDPA DQQAYWSQKA AVAAATAAAG VGSGEGVSSS TPTSQDSSTG AGDWRMQQTS  240
SCPYYSELMM SWIAGGHSET GVGVDALTTH FSSSGQFSDS FWNAVENFWE TKPVTGAF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-26471523107B-MYB
1h8a_C6e-264715223127MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7281931e-121KJ728193.1 Zea mays clone pUT6467 MYB transcription factor (MYB53) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004969273.11e-173PREDICTED: transcription factor MYB21-like
TrEMBLK3XPL41e-173K3XPL4_SETIT; Uncharacterized protein
STRINGSi003841m1e-173(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132402633
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G40350.15e-52myb domain protein 24